Loading...
Statistics
Advertisement

AKUSTÝKUSTA | Konferans Salonu | Akustik Panel | Konferans salonu ...
www.akustikusta.com/
, , AKUSTİKUSTA, Akustik Paneller , Ses İzolasyonu, Koltuklar, Ses Işık Sistemleri, Konser Salonu, Konferans Salonu, Tiyatro Salonu, Sinema Salonu ...

Akustikusta.com

Advertisement
Conversion Technology Metas Server
Akustikusta.com is hosted in Turkey . Akustikusta.com doesn't use HTTPS protocol. Number of used technologies: 6. First technologies: Carousel, CSS, Html, Number of used javascripts: 12. First javascripts: Jquery.min.js, Jquery.noconflict.js, Jquery.colorbox.js, Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Akustikusta.com

Technology

Number of occurences: 6
  • Carousel
  • CSS
  • Html
  • Javascript
  • jQuery Colorbox
  • SuperFish

Advertisement

Javascripts

Number of occurences: 12
  • jquery.min.js
  • jquery.noconflict.js
  • jquery.colorbox.js
  • jquery.infieldlabel.min.js
  • jquery.easing.1.3.js
  • jquery.quovolver.js
  • jquery.plusslider.js
  • jquery.supersubs.js
  • superfish.js
  • functions.js
  • jquery.jcarousel.pack.js
  • jquery.prettyPhoto.js

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Akustikusta.com

Missing HTTPS protocol.

    Meta - Akustikusta.com

    Number of occurences: 6
    • Name: keywords
      Content: , AKUSTİKUSTA, Akustik Paneller , Konferans Salonu , Konferans salonu tasarımı , Ses İzolasyonu, Koltuklar, Ses Işık Sistemleri, Konser Salonu, , Tiyatro Salonu, Sinema Salonu , anahyat teslim projelendirme
    • Name: description
      Content: , , AKUSTİKUSTA, Akustik Paneller , Ses İzolasyonu, Koltuklar, Ses Işık Sistemleri, Konser Salonu, Konferans Salonu, Tiyatro Salonu, Sinema Salonu , anahyat teslim projelendirme
    • Name:
      Content: text/html; charset=iso-8859-9
    • Name: Robots
      Content: index, follow
    • Name: Distribution
      Content: Global
    • Name: Rating
      Content: General

    Server / Hosting

    • IP: 94.73.150.210
    • Latitude: 41.02
    • Longitude: 28.99
    • Country: Turkey

    Rname

    • ns1.natrohost.com
    • ns2.natrohost.com
    • mx1.akustikusta.com
    • mx2.akustikusta.com

    Target

    • hostmaster.natrohost.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Sun, 11 Sep 2016 10:40:57 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=hop6vqjia70dal4b0l452idae5; path=/ Vary: Accept-Encoding Content-Type: text/html X-Cache: MISS from s_mf40 Transfer-Encoding: chunked Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

    DNS

    host: akustikusta.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 94.73.150.210
    host: akustikusta.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns1.natrohost.com
    host: akustikusta.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns2.natrohost.com
    host: akustikusta.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns1.natrohost.com
    5. rname: hostmaster.natrohost.com
    6. serial: 2013030926
    7. refresh: 10800
    8. retry: 3600
    9. expire: 777600
    10. minimum-ttl: 3600
    host: akustikusta.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx1.akustikusta.com
    host: akustikusta.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 15
    5. target: mx2.akustikusta.com
    host: akustikusta.com
    1. class: IN
    2. ttl: 1800
    3. type: TXT
    4. txt: v=spf1 include:_spfcls.natrohost.net include:_spfcls.natrohost.com ~all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.kustikusta.com, www.aokustikusta.com, www.okustikusta.com, www.apkustikusta.com, www.pkustikusta.com, www.a9kustikusta.com, www.9kustikusta.com, www.akustikusta.com, www.kustikusta.com, www.aikustikusta.com, www.ikustikusta.com, www.aukustikusta.com, www.ukustikusta.com, www.austikusta.com, www.aktustikusta.com, www.atustikusta.com, www.akustikusta.com, www.austikusta.com, www.akgustikusta.com, www.agustikusta.com, www.akbustikusta.com, www.abustikusta.com, www.aknustikusta.com, www.anustikusta.com, www.akhustikusta.com, www.ahustikusta.com, www.akyustikusta.com, www.ayustikusta.com, www.aklustikusta.com, www.alustikusta.com, www.akoustikusta.com, www.aoustikusta.com, www.akuustikusta.com, www.auustikusta.com, www.akiustikusta.com, www.aiustikusta.com, www.akmustikusta.com, www.amustikusta.com, www.akstikusta.com, www.akuwstikusta.com, www.akwstikusta.com, www.akuestikusta.com, www.akestikusta.com, www.akusstikusta.com, www.aksstikusta.com, www.akuastikusta.com, www.akastikusta.com, www.akutikusta.com, www.akusetikusta.com, www.akuetikusta.com, www.akuswtikusta.com, www.akuwtikusta.com, www.akusdtikusta.com, www.akudtikusta.com, www.akusxtikusta.com, www.akuxtikusta.com, www.akusftikusta.com, www.akuftikusta.com, www.akusgtikusta.com, www.akugtikusta.com, www.akusttikusta.com, www.akuttikusta.com, www.akusikusta.com, www.akustqikusta.com, www.akusqikusta.com, www.akustaikusta.com, www.akusaikusta.com, www.akust ikusta.com, www.akus ikusta.com, www.akustwikusta.com, www.akuswikusta.com, www.akusteikusta.com, www.akuseikusta.com, www.akustzikusta.com, www.akuszikusta.com, www.akustxikusta.com, www.akusxikusta.com, www.akustcikusta.com, www.akuscikusta.com, www.akustkusta.com, www.akustirkusta.com, www.akustrkusta.com, www.akustifkusta.com, www.akustfkusta.com, www.akustivkusta.com, www.akustvkusta.com, www.akustikkusta.com, www.akustkkusta.com, www.akusti,kusta.com, www.akust,kusta.com, www.akustibkusta.com, www.akustbkusta.com, www.akustigkusta.com, www.akustgkusta.com, www.akustitkusta.com, www.akusttkusta.com, www.akustiykusta.com, www.akustykusta.com, www.akustiukusta.com, www.akustukusta.com, www.akustijkusta.com, www.akustjkusta.com, www.akustimkusta.com, www.akustmkusta.com, www.akustinkusta.com, www.akustnkusta.com, www.akustiusta.com, www.akustiktusta.com, www.akustitusta.com, www.akustikusta.com, www.akustiusta.com, www.akustikgusta.com, www.akustigusta.com, www.akustikbusta.com, www.akustibusta.com, www.akustiknusta.com, www.akustinusta.com, www.akustikhusta.com, www.akustihusta.com, www.akustikyusta.com, www.akustiyusta.com, www.akustiklusta.com, www.akustilusta.com, www.akustikousta.com, www.akustiousta.com, www.akustikuusta.com, www.akustiuusta.com, www.akustikiusta.com, www.akustiiusta.com, www.akustikmusta.com, www.akustimusta.com, www.akustiksta.com, www.akustikuwsta.com, www.akustikwsta.com, www.akustikuesta.com, www.akustikesta.com, www.akustikussta.com, www.akustikssta.com, www.akustikuasta.com, www.akustikasta.com, www.akustikuta.com, www.akustikuseta.com, www.akustikueta.com, www.akustikuswta.com, www.akustikuwta.com, www.akustikusdta.com, www.akustikudta.com, www.akustikusxta.com, www.akustikuxta.com, www.akustikusfta.com, www.akustikufta.com, www.akustikusgta.com, www.akustikugta.com, www.akustikustta.com, www.akustikutta.com, www.akustikusa.com, www.akustikustqa.com, www.akustikusqa.com, www.akustikustaa.com, www.akustikusaa.com, www.akustikust a.com, www.akustikus a.com, www.akustikustwa.com, www.akustikuswa.com, www.akustikustea.com, www.akustikusea.com, www.akustikustza.com, www.akustikusza.com, www.akustikustxa.com, www.akustikusxa.com, www.akustikustca.com, www.akustikusca.com,

    Other websites we recently analyzed

    1. Tax Forms
      Columbus (United States) - 50.6.15.187
      Server software: Apache
      Technology: Google Adsense, Html
      Number of Javascript: 1
      Number of meta tags: 1
    2. 기업건설정보
      디스크립션
      Korea, Republic of - 112.175.85.143
      Server software: nginx
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery UI, Php
      Number of Javascript: 6
      Number of meta tags: 3
    3. ifashion
      ifashion
      Lithuania - 79.98.25.28
      G Analytics ID: UA-53267986-1
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Javascript, jQuery Colorbox, jQuery Cookie, jQuery UI, Php, Google Analytics
      Number of Javascript: 11
      Number of meta tags: 4
    4. Home - ATER Viterbo
      Azienda Territoriale per l’Edilizia Residenziale Pubblica della Provincia di Viterbo
      Arezzo (Italy) - 62.149.142.90
      Server software: Apache
      Technology: CSS, Html, Iframe, Javascript, jQuery, Php, Joomla
      Number of Javascript: 7
      Number of meta tags: 4
    5. tuckerbicycle
      Check out this GoDaddy hosted webpage! http://tuckerbicycle.com.
      Scottsdale (United States) - 97.74.42.79
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Html, Javascript, jQuery, jQuery UI
      Number of Javascript: 4
      Number of meta tags: 3
    6. Lehigh Cottage
      Scottsdale (United States) - 97.74.141.128
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery
      Number of Javascript: 4
      Number of meta tags: 4
    7. MK MEDIA - Интернет-маркетинг
      MK MEDIA - Интернет-маркетинг
      Russian Federation - 77.222.56.94
      Server software: nginx/1.9.12
      Technology: CSS, Html, Html5, Javascript, LiveInternet counter
      Number of Javascript: 1
      Number of meta tags: 4
    8. Welcome to COLORADOSPRINGSCRIMINALDEFENSELAWYER.COM
      Scottsdale (United States) - 184.168.221.96
      Server software: Microsoft-IIS/7.5
      Technology: Google Adsense, CSS, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 2
    9. Home
      Brea (United States) - 69.163.144.16
      Server software: Apache
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 6
      Number of meta tags: 2
    10. Trakehner France - Association Française du Trakehner
      Trakehner France - Site officiel de AFT - Association Française du Trakehner - Histoire - Chevaux - Elevages - Trakehner Frankreich
      United States - 159.100.190.4
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 7
      Number of meta tags: 10

    Check Other Websites